Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ATF7IP Rabbit anti-Human, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant ATF7IP.

Manufacturer:  Abnova Corporation PAB20886

Catalog No. 89-122-385

This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000.


Description

Description

Sequence: YKVKEELLKTDVKLLNGNHENGDLDPTSPLENMDYIKDKEEVNGIEEICFDPEGSKAEWKETPCILSVNVKNKQDDDLNCEPLSPHNITPEPVSKLPAEPVSGDPAPGDLDAG
Specifications

Specifications

ATF7IP
Unconjugated
Immunohistochemistry (1:200-1:500) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user.
ATF7IP
Liquid
ATF7IP
Recombinant protein corresponding to amino acids of human ATF7IP.
Antigen affinity purification
RUO
Primary
55729
Immunohistochemistry (PFA fixed), Western Blot
Rabbit polyclonal antibody raised against recombinant ATF7IP.
In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Q6VMQ6
FLJ10139|FLJ10688|MCAF|p621
Rabbit
IgG
100 uL
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only