BANK1, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant BANK1.

Supplier:  Abnova Corporation PAB23096

Catalog No. 89-124-796

Description

BANK1 is a B-cell-specific scaffold protein and LYN (MIM 165120) tyrosine kinase substrate that promotes tyrosine phosphorylation of inositol 1,4,5-trisphosphate receptors (see ITPR1; MIM 147265) (Yokoyama et al., 2002 [PubMed 11782428]).[supplied by OMIM

Sequence: RHGHKELKKIFEDFSIQEIDINNEQENDYEEDIASFSTYIPSTQNPAFHHESRKTYGQSADGAEANEMEGEGKQNGSGMETKHSPL

Specifications

• Antigen: BANK1
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant BANK1.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Accession No.: Q8NDB2
• Gene Symbols: BANK1
• Immunogen: Recombinant protein corresponding to amino acids of human BANK1.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

• Applications: Immunohistochemistry (PFA fixed), Western Blot
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:500-1:1000) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user.
• Gene: BANK1
• Gene Alias: BANK/FLJ20706/FLJ34204
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 55024
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

For Research Use Only