BCL7A, Rabbit, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-129-537	100 μL

Catalog No. 89-129-537 Supplier Abnova Corporation Supplier No. PAB28020

Description

Rabbit polyclonal antibody raised against recombinant BCL7A

This gene is directly involved, with Myc and IgH, in a three-way gene translocation in a Burkitt lymphoma cell line. As a result of the gene translocation, the N-terminal region of the gene product is disrupted, which is thought to be related to the pathogenesis of a subset of high-grade B cell non-Hodgkin lymphoma. The N-terminal segment involved in the translocation includes the region that shares a strong sequence similarity with those of BCL7B and BCL7C. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: QADGKEHPGAEDASDEQNSQSSMEHSMNSSEKVDRQPSGDSGLAAETSAISQDLEGVPPSKKMKLEASQQNSE

Specifications

• Antigen: BCL7A
• Applications: Immunohistochemistry (PFA fixed), Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant BCL7A
• Dilution: Immunohistochemistry (1:50 - 1:200) Western Blot (1:100 - 1:250) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
• Gene: BCL7A
• Gene Alias: BCL7
• Gene Symbols: BCL7A
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of human BCL7A
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 605
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG

For Research Use Only