BDKRB1 Rabbit anti-Human, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-130-129	100 μL

Catalog No. 89-130-129 Supplier Abnova Corporation Supplier No. PAB28617

Description

Rabbit polyclonal antibody raised against recombinant BDKRB1.

Bradykinin, a 9 aa peptide, is generated in pathophysiologic conditions such as inflammation, trauma, burns, shock, and allergy. Two types of G-protein coupled receptors have been found which bind bradykinin and mediate responses to these pathophysiologic conditions. The protein encoded by this gene is one of these receptors and is synthesized de novo following tissue injury. Receptor binding leads to an increase in the cytosolic calcium ion concentration, ultimately resulting in chronic and acute inflammatory responses. [provided by RefSeq

Sequence: MASSWPPLELQSSNQSQLSPQNATACDNAPEAWDLLHRVLP

Specifications

• Antigen: BDKRB1
• Applications: Immunohistochemistry (Paraffin)
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: bradykinin receptor B1
• Formulation: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
• Gene: BDKRB1
• Gene Accession No.: G3V4Y2
• Gene Alias: B1BKR, B1R, BKB1R, BKR1, BRADYB1
• Gene Symbols: BDKRB1
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of human BDKRB1.
• Purification Method: Affinity Purified
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 623
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

For Research Use Only