Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89123545

BNIP2 Rabbit anti-Human, Rat, Polyclonal Antibody, Abnova™

Catalog No. 89123545 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-123-545 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-123-545 Supplier Abnova Corporation Supplier No. PAB21843
Only null left
Add to Cart
Add to Cart

Description

Rabbit polyclonal antibody raised against recombinant BNIP2.

This gene is a member of the BCL2/adenovirus E1B 19kDa-interacting protein (BNIP) family. Though the specific function is unknown, it interacts with the E1B 19kDa protein which is responsible for the protection of virally-induced cell death, as well as E1B 19kDa-like sequences of BCL2, also an apoptotic protector. [provided by RefSeq

Sequence: VELKEEWQDEDFPIPLPEDDSIEADILAITGPEDQPGSLEVNGNKVRKKLMAPDISLTLDPSDGSVLSDDLDESGEIDLDGLDTPSENSNEFEWEDDLPKPKTTEVIRKGSITEYTAAEEKEDGRRWRMFRIGEQDHRV

Specifications

Antigen BNIP2
Applications Immunohistochemistry (PFA fixed), Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Rabbit polyclonal antibody raised against recombinant BNIP2.
Dilution Immunohistochemistry (1:200-1:500) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user.
Formulation In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Gene BNIP2
Gene Accession No. Q12982
Gene Alias BNIP-2/NIP2
Gene Symbols BNIP2
Host Species Rabbit
Immunogen Recombinant protein corresponding to amino acids of human BNIP2.
Purification Method Antigen affinity purification
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 663
Target Species Human, Rat
Content And Storage Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Form Liquid
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.