BPTF, Rabbit, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-123-952	100 μL

Catalog No. 89-123-952 Supplier Abnova Corporation Supplier No. PAB22246

Description

Rabbit polyclonal antibody raised against recombinant BPTF.

This gene was identified by the reactivity of its encoded protein to a monoclonal antibody prepared against brain homogenates from patients with Alzheimer's disease. Analysis of the original protein (fetal Alz-50 reactive clone 1, or FAC1), identified as an 810 aa protein containing a DNA-binding domain and a zinc finger motif, suggested it might play a role in the regulation of transcription. High levels of FAC1 were detected in fetal brain and in patients with neurodegenerative diseases. The protein encoded by this gene is actually much larger than originally thought, and it also contains a C-terminal bromodomain characteristic of proteins that regulate transcription during proliferation. The encoded protein is highly similar to the largest subunit of the Drosophila NURF (nucleosome remodeling factor) complex. In Drosophila, the NURF complex, which catalyzes nucleosome sliding on DNA and interacts with sequence-specific transcription factors, is necessary for the chromatin remodeling required for transcription. Two alternative transcripts encoding different isoforms have been described completely. [provided by RefSeq]

Sequence: SKLSQLKSQQVAAAAHEANKLFKEGKEVLVVNSQGEISRLSTKKEVIMKGNINNYFKLGQEGKYRVYHNQYSTNSFALNKHQHREDHDKRRHLAHKFCLTPAGEFKWNGSVHGSKVLTISTLRLTITQL

Specifications

• Antigen: BPTF
• Applications: Immunofluorescence, Immunohistochemistry (PFA fixed)
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant BPTF.
• Dilution: Immunohistochemistry (1:50-1:200) Immunofluorescence (1-4 ug/mL) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene: BPTF
• Gene Accession No.: Q12830
• Gene Alias: FAC1/FALZ/NURF301
• Gene Symbols: BPTF
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of human BPTF.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2186
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG

For Research Use Only