C17orf70 Rabbit anti-Human, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant C17orf70.

Supplier:  Abnova Corporation PAB21804

Catalog No. 89-123-506

Description

FAAP100 is a component of the Fanconi anemia (FA; MIM 277650) core complex and is required for core complex stability and FANCD2 (see MIM 227646) monoubiquitination (Ling et al., 2007 [PubMed 17396147]).[supplied by OMIM

Sequence: VLCSVSPSGSRVPHDLLGGSGGFTLEDALFGLLFGADATLLQSPVVLCGLPDGQLCCVILKALVTSRSAPGDPNALVKILHHLEEPVIFIGALKTEPQAAEAAENFLPDEDVHCDC

Specifications

• Antigen: C17orf70
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant C17orf70.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Accession No.: Q0VG06
• Gene Symbols: C17orf70
• Immunogen: Recombinant protein corresponding to amino acids of human C17orf70.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:200-1:500) The optimal working dilution should be determined by the end user.
• Gene: C17orf70
• Gene Alias: FAAP100/FLJ22175/FLJ30151
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 80233
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

For Research Use Only