Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

C6orf225, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant C6orf225.

Supplier: Abnova Corporation PAB22943

Catalog No. 89-124-642

Description

Sequence: FQFGTQPRRFPVEGGDSSIELEPGLSSSAACNGKEMSPTRQLRRCPGSHCLTITDVPVTVYATTRKPPAQSSKEMHPK

Specifications

Antigen	C6orf225
Classification	Polyclonal
Description	chromosome 6 open reading frame 225
Gene	C6orf225
Gene Alias	DKFZp586F0922
Host Species	Rabbit
Purification Method	Affinity Purified
Regulatory Status	RUO
Gene ID (Entrez)	619208
Content And Storage	Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.

Applications	Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Formulation	In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Gene Accession No.	Q4G0N7
Gene Symbols	C6orf225
Immunogen	Recombinant protein corresponding to amino acids of human C6orf225.
Quantity	100 μL
Primary or Secondary	Primary
Target Species	Human
Isotype	IgG

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

C6orf225, Rabbit, Polyclonal Antibody, Abnova™

Description

Specifications

Product Suggestions

Documents

Promotions