C8B, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant C8B.

Supplier:  Abnova Corporation PAB21600

Catalog No. 89-123-097

Description

C8 beta is one of the three subunits that comprise the component 8 (C8) of the complement system. C8 participates in the formation of Membrane Attack Complex that results in the lysis of cells. Patients with C8B deficiency are prone to bacteria infection. [provided by RefSeq

Sequence: PCQGNGVPVLKGSRCDCICPVGSQGLACEVSYRKNTPIDGKWNCWSNWSSCSGRRKTRQRQCNNPPPQNGGSPCSGPASETLDCS

Specifications

• Antigen: C8B
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant C8B.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Accession No.: P07358
• Gene Symbols: C8B
• Immunogen: Recombinant protein corresponding to amino acids of human C8B.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

• Applications: Immunohistochemistry (PFA fixed), Western Blot
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:10-1:20) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user.
• Gene: C8B
• Gene Alias: MGC163447
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 732
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

For Research Use Only