Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

C8orf37, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant C8orf37.

Manufacturer:  Abnova Corporation PAB21659

Catalog No. 89-123-356


Add to cart

Description

Description

Sequence: MAEDLDELLDEVESKFCTPDLLRRGMVEQPKGCGGGTHSSDRNQAKAKETLRSTETFKKEDDLDSLINE
Specifications

Specifications

C8orf37
Unconjugated
Immunohistochemistry (1:500-1:1000) The optimal working dilution should be determined by the end user.
C8orf37
Liquid
C8orf37
Recombinant protein corresponding to amino acids of human C8orf37.
Antigen affinity purification
RUO
Primary
157657
Immunohistochemistry (PFA fixed)
Rabbit polyclonal antibody raised against recombinant C8orf37.
In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Q96NL8
FLJ30600
Rabbit
IgG
100 uL
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only