CACNA1B, Rabbit, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-126-028	100 μL

Catalog No. 89-126-028 Supplier Abnova Corporation Supplier No. PAB24318

Description

Rabbit polyclonal antibody raised against recombinant CACNA1B.

Voltage-dependent Ca(2+) channels are multisubunit complexes found in the membrane of many excitable cells that regulate calcium entry (see MIM 601011). N-type calcium channels, which control neurotransmitter release from neurons, are dihydropyridine-insensitive and omega-conotoxin-sensitive. The alpha-1 subunit forms the pore through which calcium enters the cell, and is encoded by a family of at least 5 genes.[supplied by OMIM

Sequence: ALMIFDFYKQNKTTRDQMQQAPGGLSQMGPVSLFHPLKATLEQTQPAVLRGARVFLRQKSSTSLSNGGAIQNQESGIKESVSWGTQRTQDAPHE

Specifications

• Antigen: CACNA1B
• Applications: Immunohistochemistry (PFA fixed)
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant CACNA1B.
• Dilution: Immunohistochemistry (1:50-1:200) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene: CACNA1B
• Gene Accession No.: Q00975
• Gene Alias: BIII/CACNL1A5/CACNN/Cav2.2
• Gene Symbols: CACNA1B
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of human CACNA1B.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 774
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG

For Research Use Only