CAPN14, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant CAPN14.

Supplier:  Abnova Corporation PAB22899

Catalog No. 89-124-599

Description

Calpains are a family of cytosolic calcium-activated cysteine proteases involved in a variety of cellular processes including apoptosis, cell division, modulation of integrin-cytoskeletal interactions, and synaptic plasticity (Dear et al., 2000 [PubMed 10964513]). CAPN14 belongs to the calpain large subunit family.[supplied by OMIM

Sequence: KVFHKQDRGSGYLNWEQLHAAMREAGIMLSDDVCQLMLIRYGGPRLQMDFVSFIHLMLRVENMEDVFQNLTQDGKGIYLQKP

Specifications

• Antigen: CAPN14
• Classification: Polyclonal
• Description: calpain 14
• Gene: CAPN14
• Gene Symbols: CAPN14
• Immunogen: Recombinant protein corresponding to amino acids of human CAPN14.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Accession No.: A8MX76
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 440854
• Content And Storage: Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.

For Research Use Only