CCBL2 Rabbit anti-Human, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-123-508	100 μL

Catalog No. 89-123-508 Supplier Abnova Corporation Supplier No. PAB21806

Description

Rabbit polyclonal antibody raised against recombinant CCBL2.

This gene encodes an aminotransferase that transaminates kynurenine to form kynurenic acid. Kynurenic acid is a metabolite of tryptophan. Multiple alternatively spliced transcript variants that encode different proteins have been described for this gene. This gene shares 5' exon structure with the RNA binding motif protein, X-linked-like 1 locus on chromosome 1, but the coding sequences are nonoverlapping. [provided by RefSeq]

Sequence: VTGWKLGWSIGPNHLIKHLQTVQQNTIYTCATPLQEALAQAFWIDIKRMDDPECYFNSLPKELEVKRDRMVRLLESVG

Specifications

• Antigen: CCBL2
• Applications: Immunohistochemistry (PFA fixed), Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant CCBL2.
• Dilution: Immunohistochemistry (1:50-1:200) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene: CCBL2
• Gene Accession No.: Q6YP21
• Gene Alias: DKFZp547N1117/DKFZp667D0223/KAT3/MGC9398/RBM1/RBMXL1/RP4-531M19.2
• Gene Symbols: CCBL2
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of human CCBL2.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 56267
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG

For Research Use Only