Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CCDC153, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant CCDC153.

Manufacturer:  Abnova Corporation PAB23815

Catalog No. 89-125-523


Add to cart

Description

Description

Sequence: REEAEQALGERDQALAQLRAHMADMEAKYEEILHDSLDRLLAKLRAIKQQWDGAALRLHARHKEQQRQFGLTPPGSLRPPAPSL
Specifications

Specifications

CCDC153
Unconjugated
Immunohistochemistry (1:200-1:500) The optimal working dilution should be determined by the end user.
CCDC153
Liquid
CCDC153
Recombinant protein corresponding to amino acids of human CCDC153.
Antigen affinity purification
RUO
Primary
283152
Immunohistochemistry (PFA fixed), Western Blot
Rabbit polyclonal antibody raised against recombinant CCDC153.
In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Q494R4
MGC125447|MGC125448
Rabbit
IgG
100 uL
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only