CCT5, Rabbit, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-130-053	100 μL

Catalog No. 89-130-053 Supplier Abnova Corporation Supplier No. PAB28543

Description

Rabbit polyclonal antibody raised against recombinant CCT5.

This gene encodes a molecular chaperone that is member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized. [provided by RefSeq

Sequence: LDRGIHPIRIADGYEQAARVAIEHLDKISDSVLVDIKDTEPLIQTAKTTLGSKVVNSCHRQMAEIAVNAVLTVADMERRDVDFELIKVEGKVGGRLEDTKLIKGVIVDKDFSHPQM

Specifications

• Antigen: CCT5
• Applications: Immunohistochemistry (PFA fixed), Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant CCT5.
• Dilution: Immunohistochemistry(1:20-1:50) Western Blot(1:100-1:250) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
• Gene: CCT5
• Gene Accession No.: B4DYD8
• Gene Alias: CCT-epsilon/CCTE/KIAA0098/TCP-1-epsilon
• Gene Symbols: CCT5
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of recombinant CCT5.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 22948
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG

For Research Use Only