Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CDK5RAP2 Rabbit, Polyclonal Antibody, Abnova™

Catalog No. 89124611 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-124-611 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-124-611 Supplier Abnova Corporation Supplier No. PAB22911

Item Discontinued This item has been discontinued by the supplier. Please to view product availability in your area.

Rabbit polyclonal antibody raised against recombinant CDK5RAP2.

Neuronal CDC2-like kinase, which is involved in the regulation of neuronal differentiation, is composed of a catalytic subunit, CDK5, and an activating subunit, p25NCK5A. The protein encoded by this gene binds to p25NCK5A and therefore may be involved in neuronal differentiation. The encoded protein may also be a substrate of neuronal CDC2-like kinase. Multiple transcript variants exist for this gene, but the full-length nature of only two has been determined. [provided by RefSeq

Sequence: ELLEKLEKLFLNGKSVGVEMNTQNELMERIEEDNLTYQHLLPESPEPSASHALSDYETSEKSFFSRDQKQDNETEKTSVMV

Specifications

Antigen CDK5RAP2
Applications Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Description CDK5 regulatory subunit associated protein 2
Formulation In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Gene CDK5RAP2
Gene Accession No. Q96SN8
Gene Alias C48, Cep215, DKFZp686B1070, DKFZp686D1070, KIAA1633, MCPH3
Gene Symbols CDK5RAP2
Host Species Rabbit
Immunogen Recombinant protein corresponding to amino acids of human CDK5RAP2.
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 55755
Target Species Human
Content And Storage Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.