CLN5, Rabbit, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-129-432	100 μL

Catalog No. 89-129-432 Supplier Abnova Corporation Supplier No. PAB27910

Description

Rabbit polyclonal antibody raised against recombinant CLN5.

This gene is one of eight which have been associated with neuronal ceroid lipofuscinoses (NCL). Also referred to as Batten disease, NCL comprises a class of autosomal recessive, neurodegenerative disorders affecting children. The genes responsible likely encode proteins involved in the degradation of post-translationally modified proteins in lysosomes. The primary defect in NCL disorders is thought to be associated with lysosomal storage function

Sequence: TLTGKNYTMEWYELFQLGNCTFPHLRPEMDAPFWCNQGAACFFEGIDDVHWKENGTLVQVATISGNMFNQMAKWVKQDNETGIYYETWNVKASPEK

Specifications

• Antigen: CLN5
• Applications: Immunohistochemistry (PFA fixed), Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant CLN5.
• Dilution: Immunohistochemistry (1:500-1:1000) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
• Gene: CLN5
• Gene Alias: FLJ90628/NCL
• Gene Symbols: CLN5
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of human CLN5.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1203
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG

For Research Use Only