CNPY1, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant CNPY1.

Supplier:  Abnova Corporation PAB24533

Catalog No. 89-126-250

Description

Cnpy1 is expressed in the midbrain-hindbrain (MHB) boundary in zebrafish, binds FGFR1 (MIM 136350), and plays a role in FGF signaling (Hirate and Okamoto, 2006 [PubMed 16488878]).[supplied by OMIM

Sequence: DPVTKERTFKRFAPRKGDKIYQEFKKLYFYSDAYRPLKFACETIIEEYEDEISSLIAQETHYLADKLCSEKSDLCETSANH

Specifications

• Antigen: CNPY1
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant CNPY1.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Accession No.: Q3B7I2
• Gene Symbols: CNPY1
• Immunogen: Recombinant protein corresponding to amino acids of human CNPY1.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

• Applications: Immunohistochemistry (PFA fixed)
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:500-1:1000) The optimal working dilution should be determined by the end user.
• Gene: CNPY1
• Gene Alias: MGC125606
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 285888
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

For Research Use Only