COLEC11, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant COLEC11.

Supplier:  Abnova Corporation PAB22718

Catalog No. 89-124-426

Description

COLEC11 is a member of the collectin family of C-type lectins, which contain a collagen-like domain and a carbohydrate recognition domain, and play a role in host-defense (Keshi et al., 2006 [PubMed 17179669]).[supplied by OMIM

Sequence: INDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHTTMYFMCEFDKENM

Specifications

• Antigen: COLEC11
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant COLEC11.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Accession No.: Q9BWP8
• Gene Symbols: COLEC11
• Immunogen: Recombinant protein corresponding to amino acids of human COLEC11.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

• Applications: Immunohistochemistry (PFA fixed), Western Blot
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:200-1:500) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user.
• Gene: COLEC11
• Gene Alias: CL-K1-I/CL-K1-II/CL-K1-IIa/CL-K1-IIb/CLK1/DKFZp686N1868/MGC3279
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 78989
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

For Research Use Only