CPM, Rabbit, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-130-192	100 μL

Catalog No. 89-130-192 Supplier Abnova Corporation Supplier No. PAB28679

Description

Rabbit polyclonal antibody raised against recombinant CPM.

The protein encoded by this gene is a membrane-bound arginine/lysine carboxypeptidase. Its expression is associated with monocyte to macrophage differentiation. This encoded protein contains hydrophobic regions at the amino and carboxy termini and has 6 potential asparagine-linked glycosylation sites. The active site residues of carboxypeptidases A and B are conserved in this protein. Three alternatively spliced transcript variants encoding the same protein have been described for this gene. [provided by RefSeq

Sequence: LKTVAQNYSSVTHLHSIGKSVKGRNLWVLVVGRFPKEHRIGIPEFKYVANMHGDETVGRELLLHLIDYLVTSDGKDPEITNLINSTRIHIMPSMNPDGFEAVKKPDCYYSIGRENYNQYDLNRNFPDAFEYNNVS

Specifications

• Antigen: CPM
• Applications: Immunohistochemistry, Western Blot, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant CPM.
• Dilution: Immunohistochemistry (1:50-1:200) Western Blot (1:100-1:500) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
• Gene: CPM
• Gene Symbols: CPM
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of human CPM.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1368
• Target Species: Human, Mouse
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG

For Research Use Only