CTSD Rabbit anti-Human, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-130-140	100 μL

Catalog No. 89-130-140 Supplier Abnova Corporation Supplier No. PAB28627

Description

Rabbit polyclonal antibody raised against recombinant CTSD.

This gene encodes a lysosomal aspartyl protease composed of a dimer of disulfide-linked heavy and light chains, both produced from a single protein precursor. This proteinase, which is a member of the peptidase C1 family, has a specificity similar to but narrower than that of pepsin A. Transcription of this gene is initiated from several sites, including one which is a start site for an estrogen-regulated transcript. Mutations in this gene are involved in the pathogenesis of several diseases, including breast cancer and possibly Alzheimer disease. [provided by RefSeq

Sequence: LWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGT

Specifications

• Antigen: CTSD
• Applications: Immunohistochemistry (PFA fixed), Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant CTSD.
• Dilution: Immunohistochemistry (1:500-1:1000) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
• Gene: CTSD
• Gene Accession No.: C9JH19
• Gene Alias: CLN10/CPSD/MGC2311
• Gene Symbols: CTSD
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of human CTSD.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1509
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG

For Research Use Only