DCTN5, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant DCTN5.

Supplier:  Abnova Corporation PAB23889

Catalog No. 89-125-597

Description

Dynactin (see MIM 601143) is a multimeric protein essential for minus-end-directed transport driven by the microtubule-based motor dynein (see DYNC1H1; MIM 600112). DCTN5 is a subunit of the pointed-end subcomplex of dynactin that is thought to interact with membranous cargo (Parisi et al., 2004 [PubMed 15043994]).[supplied by OMIM

Sequence: LGELLYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGV

Specifications

• Antigen: DCTN5
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant DCTN5.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Accession No.: Q9BTE1
• Gene Symbols: DCTN5
• Immunogen: Recombinant protein corresponding to amino acids of human DCTN5.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

• Applications: Immunohistochemistry (PFA fixed), Western Blot
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:10-1:20) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user.
• Gene: DCTN5
• Gene Alias: MGC3248/p25
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 84516
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

For Research Use Only