Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

DDX27, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant DDX27.

Supplier:  Abnova Corporation PAB24527

Catalog No. 89-126-245


Only null left
Add to Cart

Description

Description

DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, the function of which has not been determined. [provided by RefSeq

Sequence: EDKEAKSGKLEKEKEAKEGSEPKEQEDLQENDEEGSEDEASETDYSSADENILTKADTLKVKDRKKKKKKGQEAGVFFEDASQYDENLSFQ
Specifications

Specifications

DDX27
Polyclonal
Rabbit polyclonal antibody raised against recombinant DDX27.
In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Q96GQ7
DDX27
Recombinant protein corresponding to amino acids of human DDX27.
100 μL
Primary
Human
Liquid
Immunohistochemistry (PFA fixed), Western Blot
Unconjugated
Immunohistochemistry (1:10-1:20) The optimal working dilution should be determined by the end user.
DDX27
DKFZp667N057/FLJ12917/FLJ20596/FLJ22238/HSPC259/MGC1018/MGC163147/PP3241/RHLP/Rrp3p/dJ686N3.1
Rabbit
Antigen affinity purification
RUO
55661
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
IgG
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.

For Research Use Only