Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89125181

DENND4B, Rabbit, Polyclonal Antibody, Abnova™

Catalog No. 89125181 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-125-181 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-125-181 Supplier Abnova Corporation Supplier No. PAB23477

Description

Rabbit polyclonal antibody raised against recombinant DENND4B.

Sequence: DSNLNTTCPFCACPFVPLLSVQTLDSRPSVPSPKSAGASGSKDAPVPGGPGPVLSDRRLCLALDEPQLCNGHMGGASRRVESGAWAYLSPLVLRKELES

Specifications

Antigen DENND4B
Applications Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Description DENN/MADD domain containing 4B
Formulation In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Gene DENND4B
Gene Accession No. O75064
Gene Alias DKFZp762N174, FLJ26202, KIAA0476
Gene Symbols DENND4B
Host Species Rabbit
Immunogen Recombinant protein corresponding to amino acids of human DENND4B.
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 9909
Target Species Human
Content And Storage Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.