Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89125664

DFNB59, Rabbit, Polyclonal Antibody, Abnova™

Catalog No. 89125664 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-125-664 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-125-664 Supplier Abnova Corporation Supplier No. PAB23959

Description

Rabbit polyclonal antibody raised against recombinant DFNB59.

The protein encoded by this gene is a member of the gasdermin family, a family which is found only in vertebrates. The encoded protein is required for the proper function of auditory pathway neurons. Defects in this gene are a cause of nonsyndromic sensorineural deafness autosomal recessive type 59 (DFNB59). [provided by RefSeq

Sequence: INFDHSLIRQSRSSRKAVLCVVMESIRTTRQCSLSVHAGIRGEAMRFHFMDEQNPKGRD

Specifications

Antigen DFNB59
Applications Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description deafness, autosomal recessive 59
Formulation In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Gene DFNB59
Gene Accession No. Q0ZLH3
Gene Alias PJVK
Gene Symbols DFNB59
Host Species Rabbit
Immunogen Recombinant protein corresponding to amino acids of human DFNB59.
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 494513
Target Species Human
Content And Storage Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.