Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

DGCR14 Rabbit anti-Human, Mouse, Rat, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant DGCR14.

Supplier:  Abnova Corporation PAB28398

Catalog No. 89-129-903


Add to Cart

Description

Description

This gene is located within the minimal DGS critical region (MDGCR) thought to contain the gene(s) responsible for a group of developmental disorders. These disorders include DiGeorge syndrome, velocardiofacial syndrome, conotruncal anomaly face syndrome, and some familial or sporadic conotruncal cardiac defects which have been associated with microdeletion of 22q11.2. The encoded protein may be a component of C complex spliceosomes, and the orthologous protein in the mouse localizes to the nucleus. [provided by RefSeq

Sequence: LRVEGSETPYVDRTPGPAFKILEPGRRERLGLKMANEAAAKNRAKKQEALRRVTENLASLTPKGLSPAMSPALQRLVSRTASKYTDRALRASYTPSPARSTHLKTPASGLQTPTSTPAPGSATRTPLTQDPASITDNL
Specifications

Specifications

DGCR14
Polyclonal
Rabbit polyclonal antibody raised against recombinant DGCR14.
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Q96DF8
DGCR14
Recombinant protein corresponding to human DGCR14.
100 μL
Primary
Human, Mouse, Rat
Liquid
Immunohistochemistry (PFA fixed), Western Blot
Unconjugated
Western Blot (1:250-1:500) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200) The optimal working dilution should be determined by the end user.
DGCR14
DGCR13/DGS-H/DGS-I/DGSH/DGSI/ES2/Es2el
Rabbit
Antigen affinity purification
RUO
8220
Store at 4 °C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
IgG
Recommendations

Recommendations

SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only