Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

DHDH, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant DHDH.

Supplier:  Abnova Corporation PAB28280

Catalog No. 89-129-786


Add to Cart

Description

Description

This gene encodes an enzyme that belongs to the family of dihydrodiol dehydrogenases, which exist in multiple forms in mammalian tissues and are involved in the metabolism of xenobiotics and sugars. These enzymes catalyze the NADP1-linked oxidation of transdihydrodiols of aromatic hydrocarbons to corresponding catechols. This enzyme is a dimeric dihydrodiol dehydrogenase, and it differs from monomeric dihydrodiol dehydrogenases in its high substrate specificity for trans-dihydrodiols of aromatic hydrocarbons in the oxidative direction. [provided by RefSeq

Sequence: LISSDFTAVLQTLPRSEHQVVAVAARDLSRAKEFAQKHDIPKAYGSYEELAKDPSVEVAYIGTQHPQHKAAVMLCLAAGKAVLCEKPT
Specifications

Specifications

DHDH
Polyclonal
Rabbit polyclonal antibody raised against recombinant DHDH.
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Q9UQ10
DHDH
Recombinant protein corresponding to amino acids of recombinant DHDH.
100 μL
Primary
Human
Liquid
Immunohistochemistry, Immunohistochemistry (Paraffin)
Unconjugated
Immunohistochemistry (1:50-1:200) The optimal working dilution should be determined by the end user.
DHDH
HUM2DD
Rabbit
Antigen affinity purification
RUO
27294
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
IgG
Recommendations

Recommendations

SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only