Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

DHRS7C Rabbit, Polyclonal Antibody, Abnova™

Catalog No. 89123574 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-123-574 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-123-574 Supplier Abnova Corporation Supplier No. PAB21871

Rabbit polyclonal antibody raised against recombinant DHRS7C.

Sequence: HTGGARLVLCGKNWERLENLYDALISVADPSKTFTPKLVLLDLSDISCVPDVAKEVLDCYGCVDILINNASVKVKG

Specifications

Antigen DHRS7C
Applications Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Description dehydrogenase/reductase (SDR family) member 7C
Formulation In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Gene DHRS7C
Gene Accession No. A6NNS2
Gene Alias SDR32C2
Gene Symbols DHRS7C
Host Species Rabbit
Immunogen Recombinant protein corresponding to amino acids of human DHRS7C.
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 201140
Target Species Human
Content And Storage Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.