Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Dhx34, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against partial recombinant Dhx34.

Manufacturer:  Abnova Corporation PAB15707

Catalog No. 89-117-772


Add to cart

Description

Description

Sequence: GPQTITTAPSLPGLFGNSTLSPHPTKGGYAVSDYLTYNCLTSDTDLYSDCLRSFWTCPHCGLHMPFTPLERIAHENTCPEAPGDDPGSEEAAPAPPQKTSALQRPYHCQVCGQDFLFTPTEVLRHRRQHV
Specifications

Specifications

Dhx34
Unconjugated
Western Blot (1:1000) The optimal working dilution should be determined by the end user.
Dhx34
Liquid
Dhx34
Recombinant GST fusion protein corresponding to 130 mouse Dhx34.
RUO
Primary
71723
Mouse
Western Blot
Rabbit polyclonal antibody raised against partial recombinant Dhx34.
In PBS (50% glycerol, 0.02% sodium azide)
AK129062
1200013B07Rik|1810012L18Rik|Ddx34|mKIAA0134
Rabbit
50 ug
Store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Polyclonal
Specific to recombinant protein GX0622. This antibody detects mDHX34 protein.
SDS
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only