DMGDH Rabbit anti-Human, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-124-700	100 μL

Catalog No. 89-124-700 Supplier Abnova Corporation Supplier No. PAB23001

Description

Rabbit polyclonal antibody raised against recombinant DMGDH.

This gene encodes an enzyme involved in the catabolism of choline, catalyzing the oxidative demethylation of dimethylglycine to form sarcosine. The enzyme is found as a monomer in the mitochondrial matrix, and uses flavin adenine dinucleotide and folate as cofactors. Mutation in this gene causes dimethylglycine dehydrogenase deficiency, characterized by a fishlike body odor, chronic muscle fatigue, and elevated levels of the muscle form of creatine kinase in serum. [provided by RefSeq

Sequence: TLATDDVDPEGNESIWYNGKVVGNTTSGSYSYSIQKSLAFAYVPVQLSEVGQQVEVELLGKNYPAVIIQEPLVLTEPTRNRLQK

Specifications

• Antigen: DMGDH
• Applications: Immunohistochemistry (PFA fixed)
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant DMGDH.
• Dilution: Immunohistochemistry (1:20-1:50) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene: DMGDH
• Gene Accession No.: Q9UI17
• Gene Alias: DMGDHD/ME2GLYDH
• Gene Symbols: DMGDH
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of human DMGDH.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 29958
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG

For Research Use Only