DNAH8, Rabbit, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-123-861	100 μL

Catalog No. 89-123-861 Supplier Abnova Corporation Supplier No. PAB22154

Description

Rabbit polyclonal antibody raised against recombinant DNAH8.

Dyneins are microtubule-associated motor protein complexes composed of several heavy, light, and intermediate chains. Dynein heavy chains (DHCs) are responsible for force production and ATPase activity and contain a highly conserved catalytic domain with 4 P-loop consensus motifs involved in nucleotide binding. Two major classes of dyneins, axonemal and cytoplasmic, have been identified. Axonemal dyneins, found in cilia and flagella, are components of the outer and inner dynein arms attached to the peripheral microtubule doublets. DNAH8 is an outer arm axonemal DHC (Chapelin et al., 1997 [PubMed 9256245]; Neesen et al., 1997 [PubMed 9373155]).[supplied by OMIM

Sequence: ILNHKSKHVEEAVRELISIFEQIYEVKYTGKVGKQSEQRKHVVFGSETEEGENNDYEANIVNEFDTHDKEDEFKKECKEVFAFFSHQLLDSLQKATRLSLD

Specifications

• Antigen: DNAH8
• Applications: Immunohistochemistry (PFA fixed)
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant DNAH8.
• Dilution: Immunohistochemistry (1:500-1:1000) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene: DNAH8
• Gene Accession No.: Q96JB1
• Gene Alias: ATPase/FLJ25850/FLJ36115/FLJ36334/hdhc9
• Gene Symbols: DNAH8
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of human DNAH8.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1769
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG

For Research Use Only