DNAJC6, Rabbit, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-124-234	100 μL

Catalog No. 89-124-234 Supplier Abnova Corporation Supplier No. PAB22525

Description

Rabbit polyclonal antibody raised against recombinant DNAJC6.

DNAJC6 belongs to the evolutionarily conserved DNAJ/HSP40 family of proteins, which regulate molecular chaperone activity by stimulating ATPase activity. DNAJ proteins may have up to 3 distinct domains: a conserved 70-amino acid J domain, usually at the N terminus, a glycine/phenylalanine (G/F)-rich region, and a cysteine-rich domain containing 4 motifs resembling a zinc finger domain (Ohtsuka and Hata, 2000 [PubMed 11147971]).[supplied by OMIM

Sequence: NGDKPHGVKKPSKKQQEPAAPPPPEDVDLLGLEGSAMSNSFSPPAAPPTNSELLSDLFGGGGAAGPTQAGQSGVEDVFHPSGPASTQSTP

Specifications

• Antigen: DNAJC6
• Applications: Immunohistochemistry (PFA fixed), Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant DNAJC6.
• Dilution: Immunohistochemistry (1:200-1:500) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene: DNAJC6
• Gene Accession No.: O75061
• Gene Alias: DJC6/KIAA0473/MGC129914/MGC129915/MGC48436
• Gene Symbols: DNAJC6
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of human DNAJC6.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 9829
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG

For Research Use Only