DPRX, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant DPRX.

Supplier:  Abnova Corporation PAB28150

Catalog No. 89-129-658

Description

Homeobox genes encode DNA-binding proteins, many of which are thought to be involved in early embryonic development. Homeobox genes encode a DNA-binding domain of 60 to 63 amino acids referred to as the homeodomain. This gene is a member of the DPRX homeobox gene family. Evidence of mRNA expression has not yet been found for this gene. Multiple, related processed pseudogenes have been found which are thought to reflect expression of this gene in the germ line or embryonic cells. [provided by RefSeq

Sequence: GVSTSVGLRNADTLPRLPNAAHPIGLVYTGHRVPSFQLILYPNLKVPANDFIGHRIVHFGCCRDPNIYCLYPILESQVCAPSFHSGSPACSSNQSR

Specifications

• Antigen: DPRX
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant DPRX.
• Formulation: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
• Gene Accession No.: A6NFQ7
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 503834
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:200-1:500) The optimal working dilution should be determined by the end user.
• Gene: DPRX
• Gene Symbols: DPRX
• Immunogen: Recombinant protein corresponding to amino acids of recombinant DPRX.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

For Research Use Only