DSCR3 Rabbit anti-Human, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-123-048	100 μL

Catalog No. 89-123-048 Supplier Abnova Corporation Supplier No. PAB21553

Description

Rabbit polyclonal antibody raised against recombinant DSCR3.

The region of chromosome 21 between genes CBR and ERG (CBR-ERG region), which spans 2.5Mb on 21q22.2, has been defined by analysis of patients with partial trisomy 21. It contributes significantly to the pathogenesis of many characteristics of Down syndrome, including morphological features, hypotonia, and mental retardation. The DSCR3 (Down syndrome critical region gene 3) gene is found in this region and is predictated to contain eight exons. DSCR3 is expressed in most tissues examined. [provided by RefSeq

Sequence: GKFPSGKTEIPFEFPLHLKGNKVLYETYHGVFVNIQYTLRCDMKRSLLAKDLTKTCEFIVHSAPQKGKFTPSPV

Specifications

• Antigen: DSCR3
• Applications: Immunohistochemistry (PFA fixed)
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant DSCR3.
• Dilution: Immunohistochemistry (1:200-1:500) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene: DSCR3
• Gene Accession No.: O14972
• Gene Alias: DCRA/DSCRA/MGC117385
• Gene Symbols: DSCR3
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of human DSCR3.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 10311
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG

For Research Use Only