Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89129827

DUSP23 Rabbit anti-Human, Polyclonal Antibody, Abnova™

Catalog No. 89129827 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-129-827 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-129-827 Supplier Abnova Corporation Supplier No. PAB28324
Add to Cart
Add to Cart

Description

Rabbit polyclonal antibody raised against recombinant DUSP23.

Sequence: IVDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAAGDAIAEIRRLRPGSIETYEQEKAVFQFYQRTK

Specifications

Antigen DUSP23
Applications Immunohistochemistry, Western Blot, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Rabbit polyclonal antibody raised against recombinant DUSP23.
Dilution Immunohistochemistry (1:50-1:200) Western Blot (1:500-1:1000) The optimal working dilution should be determined by the end user.
Formulation In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene DUSP23
Gene Accession No. Q9BVJ7
Gene Alias DUSP25/FLJ20442/LDP-3/MOSP/RP11-190A12.1/VHZ
Gene Symbols DUSP23
Host Species Rabbit
Immunogen Recombinant protein corresponding to amino acids of recombinant DUSP23.
Purification Method Antigen affinity purification
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 54935
Target Species Human
Content And Storage Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Form Liquid
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.