EDARADD, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant EDARADD.

Supplier:  Abnova Corporation PAB21049

Catalog No. 89-122-545

Description

This gene was identified by its association with ectodermal dysplasia, a genetic disorder characterized by defective development of hair, teeth, and eccrine sweat glands. The protein encoded by this gene is a death domain-containing protein, and is found to interact with EDAR, a death domain receptor known to be required for the development of hair, teeth and other ectodermal derivatives. This protein and EDAR are coexpressed in epithelial cells during the formation of hair follicles and teeth. Through its interaction with EDAR, this protein acts as an adaptor, and links the receptor to downstream signaling pathways. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq

Sequence: PTISDLLNDQDLLDVIRIKLDPCHPTVKNWRNFASKWGMSYDELCFLEQRPQSPTLEFLLRNSQRTVGQLMELCRLYHRADVEKVLRRWVDEEWPKRERGDP

Specifications

• Antigen: EDARADD
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant EDARADD.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Accession No.: Q8WWZ3
• Gene Symbols: EDARADD
• Immunogen: Recombinant protein corresponding to amino acids of human EDARADD.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

• Applications: Immunohistochemistry (PFA fixed)
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:50-1:200) The optimal working dilution should be determined by the end user.
• Gene: EDARADD
• Gene Alias: ED3/EDA3
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 128178
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

For Research Use Only