EXOC2 Rabbit anti-Human, Mouse, Rat, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant EXOC2.

Supplier:  Abnova Corporation PAB22609

Catalog No. 89-124-321

Description

The protein encoded by this gene is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component proteins and the functions of the exocyst complex have been demonstrated to be highly conserved in higher eukaryotes. At least eight components of the exocyst complex, including this protein, are found to interact with the actin cytoskeletal remodeling and vesicle transport machinery. This interaction has been shown to mediate filopodia formation in fibroblasts. [provided by RefSeq

Sequence: IIVTTKSGGRGTSTVSFKLLKPEKIGILDQSAVWVDEMNYYDMRTDRNKGIPPLSLRPANPLGIEIEKSKFSQKDLEMLFHGMSADFTS

Specifications

• Antigen: EXOC2
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant EXOC2.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Accession No.: Q96KP1
• Gene Symbols: EXOC2
• Immunogen: Recombinant protein corresponding to amino acids of human EXOC2.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Liquid

• Applications: Immunohistochemistry (PFA fixed), Western Blot
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:2500-1:5000) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user.
• Gene: EXOC2
• Gene Alias: FLJ11026/SEC5/SEC5L1/Sec5p
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 55770
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

For Research Use Only