Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89124676

EXOC6, Rabbit, Polyclonal Antibody, Abnova™

Catalog No. 89124676 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-124-676 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-124-676 Supplier Abnova Corporation Supplier No. PAB22976
Add to Cart
Add to Cart

Description

Rabbit polyclonal antibody raised against recombinant EXOC6.

The product of this gene belongs to the SEC15 family. It is highly similar to the protein encoded by Saccharomyces cerevisiae SEC15 gene. This protein is essential for vesicular traffic from the Golgi apparatus to the cell surface in yeast. It is one of the components of a multiprotein complex required for exocytosis. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq

Sequence: TFSVSLQKQNKMKFGKNMYINRDRIPEERNETVLKHSLEEE

Specifications

Antigen EXOC6
Applications Immunohistochemistry (PFA fixed), Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Rabbit polyclonal antibody raised against recombinant EXOC6.
Dilution Immunohistochemistry (1:200-1:500) The optimal working dilution should be determined by the end user.
Formulation In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Gene EXOC6
Gene Accession No. Q8TAG9
Gene Alias DKFZp761I2124/EXOC6A/FLJ1125/FLJ11251/MGC33397/SEC15/SEC15L/SEC15L1/SEC15L3/Sec15p
Gene Symbols EXOC6
Host Species Rabbit
Immunogen Recombinant protein corresponding to amino acids of human EXOC6.
Purification Method Antigen affinity purification
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 54536
Target Species Human
Content And Storage Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Form Liquid
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.