FAM186B Rabbit anti-Human, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant FAM186B.

Supplier:  Abnova Corporation PAB23576

Catalog No. 89-125-281

Description

This gene product is a member of the FAM186 family, however, its exact function is not known. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq

Sequence: SLIATKRGIESLTALCSTLIEGQKKRSQVSKRTFWQGWQGRSPQTSPSHPQPLSPEQMLQDQHTMNTKASEVTSMLQELLDSTMFSK

Specifications

• Antigen: FAM186B
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant FAM186B.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Accession No.: Q8IYM0
• Gene Symbols: FAM186B
• Immunogen: Recombinant protein corresponding to amino acids of human FAM186B.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

• Applications: Immunohistochemistry, Western Blot
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:50-1:200) The optimal working dilution should be determined by the end user.
• Gene: FAM186B
• Gene Alias: C12orf25/DKFZp434J0113/DKFZp434N2350
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 84070
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

For Research Use Only