FLII Rabbit anti-Human, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-121-963	100 μL

Catalog No. 89-121-963 Supplier Abnova Corporation Supplier No. PAB20459

Description

Rabbit polyclonal antibody raised against recombinant FLII.

This gene encodes a protein with a gelsolin-like actin binding domain and an N-terminal leucine-rich repeat-protein protein interaction domain. The protein is similar to a Drosophila protein involved in early embryogenesis and the structural organization of indirect flight muscle. The gene is located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq

Sequence: YILDCWSDVFIWLGRKSPRLVRAAALKLGQELCGMLHRPRHATVSRSLEGTEAQVFKAKFKNWDDVLTVDYTRNAEAVLQSPGLSGKVKRDAEKKDQMKADLTALFLPRQPPMSLAEAEQLMEEWNEDL

Specifications

• Antigen: FLII
• Applications: Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant FLII.
• Dilution: Immunohistochemistry (1:50-1:200) Western Blot (1:250-1:500) Immunofluorescence (1-4 ug/mL) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene: FLII
• Gene Accession No.: Q13045
• Gene Alias: FLI/FLIL/Fli1/MGC39265
• Gene Symbols: FLII
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of human FLII.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2314
• Target Species: Human, Mouse
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG

For Research Use Only