Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Fnbp1, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against partial recombinant Fnbp1.

Manufacturer:  Abnova Corporation PAB15703

Catalog No. 89-117-768


Add to cart

Description

Description

Sequence: QRFNQEQWEYYHTHIPNIFQKIQEMEERRIVRIGESMKTYAEVDRQVIPIIGKCLDGIVKAAESIDQKNDSQLVVEAYKSGFEPPGDIEFEDYTQPMKRTVSDNSLSSSKEGKPELRFGGKSRGKLWPFIKKNKLMSLLTSPHQ
Specifications

Specifications

Fnbp1
Unconjugated
The optimal working dilution should be determined by the end user.
Fnbp1
Liquid
Fnbp1
Recombinant GST fusion protein corresponding to 144 mouse Fnbp1.
RUO
Primary
14269
Mouse
Immunohistochemistry
Rabbit polyclonal antibody raised against partial recombinant Fnbp1.
In PBS (50% glycerol, 0.02% sodium azide)
AK122308
1110057E06Rik|2210010H06Rik|FBP1|Fbp17
Rabbit
100 ug
Store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Polyclonal
Specific to recombinant protein GX0310. This antibody detects endogenous mFNBP1 protein in cerebellar bergmann glia cells.
SDS
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only