Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89131708

GAL Rabbit anti-Human, Polyclonal Antibody, Abnova™

Catalog No. 89131708 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
150 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-131-708 150 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-131-708 Supplier Abnova Corporation Supplier No. PAB5055
Add to Cart
Add to Cart

Description

Rabbit polyclonal antibody raised against synthetic peptide of GAL.

Galanin is small neuropeptide that functions as a cellular messenger within the central and peripheral nervous systems, modulating diverse physiologic functions (Mechenthaler, 2008 [PubMed 18500643]).[supplied by OMIM

Sequence: GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS

Specifications

Antigen GAL
Applications ELISA, Immunoprecipitation
Classification Polyclonal
Conjugate Unconjugated
Description Rabbit polyclonal antibody raised against synthetic peptide of GAL.
Dilution The optimal working dilution should be determined by the end user.
Formulation In PBS, pH 7.5 (50% glycerol, 0.01% thimerosal)
Gene GAL
Gene Alias GALN/GLNN/GMAP/MGC40167
Gene Symbols GAL
Host Species Rabbit
Immunogen A synthetic peptide (conjugated with KLH) corresponding to human GAL.
Quantity 150 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 51083
Target Species Human
Content And Storage Store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Form Liquid
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.