GCET2, Rabbit, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-130-181	100 μL

Catalog No. 89-130-181 Supplier Abnova Corporation Supplier No. PAB28669

Description

Rabbit polyclonal antibody raised against recombinant GCET2.

This gene encodes a protein which may function in signal transduction pathways and whose expression is elevated in germinal cell lymphomas. It contains a putative PDZ-interacting domain, an immunoreceptor tyrosine-based activation motif (ITAM), and two putative SH2 binding sites. In B cells, its expression is specifically induced by interleukin-4. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq

Sequence: HIAEGCFCLPWKKILIFEKRQDSQNENERMSSTPIQDNVDQTYSEELCYTLINHRVLCTRPSGNSAEEYYENVPCKAERPRESLGGTETEYSLLHMPSTDPRHARSPEDEYELLMPHRISSHFL

Specifications

• Antigen: GCET2
• Applications: Immunohistochemistry, Western Blot, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant GCET2.
• Dilution: Immunohistochemistry (1:200-1:500) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
• Gene: GCET2
• Gene Alias: GCAT2/HGAL/MGC40441
• Gene Symbols: GCET2
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of human GCET2.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 257144
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG

For Research Use Only