GFM1 Rabbit anti-Human, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-124-534	100 μL

Catalog No. 89-124-534 Supplier Abnova Corporation Supplier No. PAB22827

Description

Rabbit polyclonal antibody raised against recombinant GFM1.

Eukaryotes contain two protein translational systems, one in the cytoplasm and one in the mitochondria. Mitochondrial translation is crucial for maintaining mitochondrial function and mutations in this system lead to a breakdown in the respiratory chain-oxidative phosphorylation system and to impaired maintenance of mitochondrial DNA. This gene encodes one of the mitochondrial translation elongation factors. Its role in the regulation of normal mitochondrial function and in different disease states attributed to mitochondrial dysfunction is not known. [provided by RefSeq

Sequence: QYGKVIGVLEPLDPEDYTKLEFSDETFGSNIPKQFVPAVEKGFLDACEKGPLSGHKLSGLRFVLQDGAHHMVDSNEISFIRAGE

Specifications

• Antigen: GFM1
• Applications: Immunohistochemistry (PFA fixed), Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant GFM1.
• Dilution: Immunohistochemistry (1:10-1:20) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene: GFM1
• Gene Accession No.: Q96RP9
• Gene Alias: COXPD1/EFG/EFG1/EFGM/EGF1/FLJ12662/FLJ13632/FLJ20773/GFM/hEFG1
• Gene Symbols: GFM1
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of human GFM1.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 85476
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG

For Research Use Only