Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89131674

GHRH, Rabbit, Polyclonal Antibody, Abnova™

Catalog No. 89131674 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
150 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-131-674 150 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-131-674 Supplier Abnova Corporation Supplier No. PAB4992
Add to Cart
Add to Cart

Description

Rabbit polyclonal antibody raised against synthetic peptide of GHRH.

The protein encoded by this gene belongs to the glucagon family and is a preproprotein that is produced in the hypothalamus. The preproprotein is cleaved to form a 44 aa factor, also called somatocrinin, that acts to stimulate growth hormone release from the pituitary. Variant receptors for somatocrinin have been found in several types of tumors, and antagonists of these receptors can inhibit the growth of the tumors. Defects in this gene are a cause of dwarfism, while hypersecretion of the encoded protein is a cause of gigantism. [provided by RefSeq

Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL

Specifications

Antigen GHRH
Applications ELISA, Immunoprecipitation
Classification Polyclonal
Conjugate Unconjugated
Description Rabbit polyclonal antibody raised against synthetic peptide of GHRH.
Dilution The optimal working dilution should be determined by the end user.
Formulation In PBS, pH 7.5 (50% glycerol, 0.01% thimerosal)
Gene GHRH
Gene Alias GHRF/GRF/MGC119781
Gene Symbols GHRH
Host Species Rabbit
Immunogen A synthetic peptide (conjugated with KLH) corresponding to human GHRH.
Quantity 150 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2691
Target Species Human
Content And Storage Store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Form Liquid
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.