GPHN, Rabbit, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-130-253	100 μL

Catalog No. 89-130-253 Supplier Abnova Corporation Supplier No. PAB28735

Description

Rabbit polyclonal antibody raised against recombinant GPHN.

This gene encodes a neuronal assembly protein that anchors inhibitory neurotransmitter receptors to the postsynaptic cytoskeleton via high affinity binding to a receptor subunit domain and tubulin dimers. In nonneuronal tissues, the encoded protein is also required for molybdenum cofactor biosynthesis. Mutations in this gene may be associated with the neurological condition hyperplexia and also lead to molybdenum cofactor deficiency. Numerous alternatively spliced transcript variants encoding different isoforms have been described; however, the full-length nature of all transcript variants is not currently known. [provided by RefSeq

Sequence: ATIQEHGYPTINLGIVGDNPDDLLNALNEGISRADVIITSGGVSMGEKDYLKQVLDIDLHAQIHFGRVFMKPGLPTTFATLDIDGVRKIIFALPGNPVSAVVTCNLFVVPALRKMQGILDPRPTIIKARLSCDVKLDPRPEY

Specifications

• Antigen: GPHN
• Applications: Immunohistochemistry, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant GPHN.
• Dilution: Immunohistochemistry (1:20-1:50) Western Blot (1:100 - 1:250) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
• Gene: GPHN
• Gene Alias: GEPH/GPH/GPHRYN/KIAA1385
• Gene Symbols: GPHN
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of human GPHN.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 10243
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG

For Research Use Only