GPX2, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant GPX2

Supplier:  Abnova Corporation PAB28006

Catalog No. 89-129-521

Description

This gene is a member of the glutathione peroxidase family and encodes a selenium-dependent glutathione peroxidase that is one of two isoenzymes responsible for the majority of the glutathione-dependent hydrogen peroxide-reducing activity in the epithelium of the gastrointestinal tract. Studies in knockout mice indicate that mRNA expression levels respond to luminal microflora, suggesting a role of the ileal glutathione peroxidases in preventing inflammation in the GI tract. [provided by RefSeq

Sequence: VLGFPCNQFGHQENCQNEEILNSLKYVRPGGGYQPTFTLVQKCEVNGQNEHPVFAYLKDKLPYPYDDPFSLMTDPKLIIWSPVRRSDVA

Specifications

• Antigen: GPX2
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant GPX2
• Formulation: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
• Gene Alias: GI-GPx/GPRP/GSHPX-GI/GSHPx-2
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 2877
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:50-1:200) The optimal working dilution should be determined by the end user.
• Gene: GPX2
• Gene Symbols: GPX2
• Immunogen: Recombinant protein corresponding to amino acids of human GPX2
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

For Research Use Only