GRID2IP, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant GRID2IP.

Supplier:  Abnova Corporation PAB24407

Catalog No. 89-126-120

Description

Glutamate receptor delta-2 (GRID2; MIM 602368) is predominantly expressed at parallel fiber-Purkinje cell postsynapses and plays crucial roles in synaptogenesis and synaptic plasticity. GRID2IP1 interacts with GRID2 and may control GRID2 signaling in Purkinje cells (Matsuda et al., 2006 [PubMed 16835239]).[supplied by OMIM

Sequence: SETSHMSVKRLRWEQVENSEGTIWGQLGEDSDYDKLSDMVKYLDLELHFGTQKPAKPVPGPEPFRKKEVVEILSHKKAYNTSILLAHLKLSPAELRQVLMSMEP

Specifications

• Antigen: GRID2IP
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant GRID2IP.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Accession No.: A4D2P6
• Gene Symbols: GRID2IP
• Immunogen: Recombinant protein corresponding to amino acids of human GRID2IP.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

• Applications: Immunohistochemistry (PFA fixed)
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:20-1:50) The optimal working dilution should be determined by the end user.
• Gene: GRID2IP
• Gene Alias: DELPHILIN
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 392862
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

For Research Use Only