GSPT2, Rabbit, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-126-069	100 μL

Catalog No. 89-126-069 Supplier Abnova Corporation Supplier No. PAB24359

Description

Rabbit polyclonal antibody raised against recombinant GSPT2.

GSPT2 is closely related to GSPT1 (MIM 139259), a GTP-binding protein that plays an essential role at the G1- to S-phase transition of the cell cycle in yeast and human cells. GSPT1 is a positive regulator of translational accuracy and, in a binary complex with eRF1 (MIM 600285), functions as a polypeptide chain release factor.[supplied by OMIM

Sequence: TQPPTLPAGSGSNDETCTGAGYPQGKRMGRGAPVEPSREEPLVSLEGSNSAVT

Specifications

• Antigen: GSPT2
• Applications: Immunohistochemistry (PFA fixed), Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant GSPT2.
• Dilution: Immunohistochemistry (1:10-1:20) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene: GSPT2
• Gene Accession No.: Q8IYD1
• Gene Alias: FLJ10441/GST2/eRF3b
• Gene Symbols: GSPT2
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of human GSPT2.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 23708
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG

For Research Use Only