HDLBP Rabbit anti-Human, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant HDLBP.

Supplier:  Abnova Corporation PAB20269

Catalog No. 89-121-772

Description

High density lipoprotein-binding protein, also known as vigilin, is a 110kDa protein that specifically binds HDL molecules and may function in the removal of excess cellular cholesterol.[supplied by OMIM

Sequence: DMNQFGEGEQAKICLEIMQRTGAHLELSLAKDQGLSIMVSGKLDAVMKARKDIVARLQTQASATVAIPKEHHRFVIGKNGEKLQDLELKTATKIQIPRPDDPSNQIKITGTKEGIEKARHEVLLISAEQDKRAVE

Specifications

• Antigen: HDLBP
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant HDLBP.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Alias: FLJ16432/HBP/PRO2900/VGL
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 3069
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunofluorescence, Immunohistochemistry (PFA fixed)
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:200-1:500) Immunofluorescence (1-4 ug/mL) The optimal working dilution should be determined by the end user.
• Gene: HDLBP
• Gene Symbols: HDLBP
• Immunogen: Recombinant protein corresponding to amino acids of human HDLBP.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

For Research Use Only